Rabbit Polyclonal FALDH Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal FALDH Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Aldh3A2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Aldh3A2 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human Aldh3A2. |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the middle region of human ALDH3A2. Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | WB |
Reactivities | Human, Monkey, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI 1B11 (formerly 1B11)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | FC, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)
Applications | WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ALDH3A2 |
USD 379.00
In Stock
ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | WB |
Reactivities | Human, Monkey, Rat |
Conjugation | Unconjugated |
USD 159.00
2 Days
ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | WB |
Reactivities | Human, Monkey, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
ALDH3A2 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 159.00
2 Days
ALDH3A2 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
ALDH3A2 mouse monoclonal antibody, clone OTI 1B11 (formerly 1B11)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 159.00
2 Days
ALDH3A2 mouse monoclonal antibody, clone OTI 1B11 (formerly 1B11)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
ALDH3A2 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 159.00
2 Days
ALDH3A2 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | FC, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 159.00
2 Days
ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | FC, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)
Applications | WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
USD 159.00
2 Days
ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)
Applications | WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".