Antibodies

Jump to Filters
View as table Download
Adgrl1 Rabbit Polyclonal Antibody
TA328869

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-Latrophilin-1 (extracellular)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CEPREVRRVQWPATQ(G), corresponding to amino acid residues 480-494 of rat Latrophilin-1. Extracellular, N-terminus.
LPHN1 (ADGRL1) Rabbit Polyclonal Antibody
TA338344

USD 375.00

5 Days

Rabbit Polyclonal Anti-LPHN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LPHN1 antibody is: synthetic peptide directed towards the C-terminal region of Human LPHN1. Synthetic peptide located within the following region: YSLRSGDFPPGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAK