Rabbit Polyclonal Alas1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 480-530 of human ALAS-1 were used as the immunogen. |
Rabbit Polyclonal Alas1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 480-530 of human ALAS-1 were used as the immunogen. |
Rabbit Polyclonal Anti-ALAS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ALAS1 Antibody: synthetic peptide directed towards the N terminal of human ALAS1. Synthetic peptide located within the following region: ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS |
Carrier-free (BSA/glycerol-free) ALAS1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALAS1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ALAS1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ALAS1 |
ALAS1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human ALAS1 (NP_954635.1). |
Modifications | Unmodified |
ALAS1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ALAS1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ALAS1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ALAS1 mouse monoclonal antibody, clone OTI5D5 (formerly 5D5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |