Rabbit anti-APTX Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human APTX |
Rabbit anti-APTX Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human APTX |
Rabbit Polyclonal Anti-APTX Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-APTX antibody: synthetic peptide directed towards the C terminal of human APTX. Synthetic peptide located within the following region: VIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLRKHWTQ |