Antibodies

View as table Download

Rabbit Polyclonal CDR2 Antibody

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the human protein. [Swiss-prot# Q01850]

Mouse Monoclonal CDR2 Antibody (33)

Applications IHC, WB
Reactivities Human, Mouse (Negative)
Conjugation Unconjugated

Rabbit Polyclonal Anti-CDR2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDR2 antibody: synthetic peptide directed towards the N terminal of human CDR2. Synthetic peptide located within the following region: MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQ