Rabbit Polyclonal CDR2 Antibody
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal region of the human protein. [Swiss-prot# Q01850] |
Rabbit Polyclonal CDR2 Antibody
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal region of the human protein. [Swiss-prot# Q01850] |
Mouse Monoclonal CDR2 Antibody (33)
Applications | IHC, WB |
Reactivities | Human, Mouse (Negative) |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CDR2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDR2 antibody: synthetic peptide directed towards the N terminal of human CDR2. Synthetic peptide located within the following region: MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQ |