Rabbit Polyclonal Anti-COX15 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COX15 antibody: synthetic peptide directed towards the N terminal of human COX15. Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY |
Mouse Monoclonal anti-Cytochrome c Antibody
| Applications | WB |
| Reactivities | Most Species |
| Conjugation | Unconjugated |
COX15 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human COX15 (NP_510870.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
