Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CSTB Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSTB Antibody: A synthesized peptide derived from human CSTB |
Rabbit Polyclonal Anti-CSTB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSTB antibody: synthetic peptide directed towards the middle region of human CSTB. Synthetic peptide located within the following region: AGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF |
Rabbit Polyclonal Anti-CSTB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSTB antibody: synthetic peptide directed towards the N terminal of human CSTB. Synthetic peptide located within the following region: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAG |
Goat Anti-Cystatin B / Stefin B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QTNKAKHDELTYF, from the C Terminus of the protein sequence according to NP_000091.1. |
CSTB Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse CSTB |
CSTB Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human CSTB (NP_000091.1). |
| Modifications | Unmodified |
CSTB mouse monoclonal antibody,clone OTI1E8
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CSTB mouse monoclonal antibody,clone OTI1F12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CSTB mouse monoclonal antibody,clone OTI2A7
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CSTB mouse monoclonal antibody,clone OTI3D5
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CSTB mouse monoclonal antibody,clone OTI5F2
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- CSTB
Applications
- WB
Conjugates
- Unconjugated