Antibodies

Jump to Filters
View as table Download
GCP2 (CXCL6) Rabbit Polyclonal Antibody
TA328320

USD 285.00

5 Days

Anti-Human GCP-2 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human GCP-2 (CXCL6)
GCP2 (CXCL6) Rabbit Polyclonal Antibody
TA329198

USD 375.00

5 Days

Rabbit Polyclonal anti-CXCL6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCL6 antibody: synthetic peptide directed towards the middle region of human CXCL6. Synthetic peptide located within the following region: GKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKK
GCP2 (CXCL6) Rabbit Polyclonal Antibody
TA375245

USD 220.00

3 Weeks

CXCL6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 38-114 of human CXCL6 (NP_002984.1).