Goat Anti-CYB5R3 / Dia 1 (mouse) Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PNLERVGHPKERC, from the C-Terminus of the protein sequence according to NP_084063.1. |
Goat Anti-CYB5R3 / Dia 1 (mouse) Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PNLERVGHPKERC, from the C-Terminus of the protein sequence according to NP_084063.1. |
Rabbit polyclonal anti-CYB5R3 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CYB5R3. |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CYB5R3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYB5R3 antibody: synthetic peptide directed towards the C terminal of human CYB5R3. Synthetic peptide located within the following region: IRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLD |
Carrier-free (BSA/glycerol-free) CYB5R3 mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CYB5R3 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CYB5R3 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CYB5R3 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 125-334 of human CYB5R3 (NP_001165131.1). |
Modifications | Unmodified |
CYB5R3 mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CYB5R3 mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CYB5R3 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
CYB5R3 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Anti-CYB5R3 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-CYB5R3 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-CYB5R3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYB5R3 |
Rabbit Polyclonal anti-CYB5R3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYB5R3 |