Antibodies

Jump to Filters
View as table Download
DIP2A Rabbit Polyclonal Antibody
TA338932

USD 375.00

5 Days

Rabbit Polyclonal Anti-DIP2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DIP2A antibody: synthetic peptide directed towards the N terminal of human DIP2A. Synthetic peptide located within the following region: PLKEFFVDDFEELLEVQQPDPNQPKPEGSETSVLRGEPLTAGVPRPPSLL
DIP2A Rabbit Polyclonal Antibody
TA360376

USD 360.00

5 Days

DIP2A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DIP2A