Antibodies

Jump to Filters
View as table Download
GRIP1 Rabbit Polyclonal Antibody
TA319860

USD 430.00

5 Days

Rabbit Polyclonal GRIP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal GRIP1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human GRIP1.
GRIP1 Rabbit Polyclonal Antibody
TA330572

USD 375.00

5 Days

Rabbit Polyclonal Anti-GRIP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRIP1 antibody: synthetic peptide directed towards the C terminal of human GRIP1. Synthetic peptide located within the following region: RQASFQERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKEIMSPTP
GRIP1 Rabbit Polyclonal Antibody
TA355540

USD 300.00

5 Days

GRIP1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GRIP1
GRIP1 Rabbit Polyclonal Antibody
TA376793

USD 220.00

3 Weeks

GRIP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 700-950 of human GRIP1 (NP_001171545.1).
Modifications Unmodified
GRIP1 Rabbit Polyclonal Antibody
TA376794

USD 220.00

3 Weeks

GRIP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human GRIP1 (NP_001171545.1).
Modifications Unmodified