Antibodies

Jump to Filters
View as table Download
Glycogen synthase 2 (GYS2) Rabbit Polyclonal Antibody
TA338005

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-GYS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GYS2 antibody: synthetic peptide directed towards the middle region of human GYS2. Synthetic peptide located within the following region: TLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVED
Glycogen synthase 2 (GYS2) Rabbit Polyclonal Antibody
TA376891

USD 220.00

3 Weeks

GYS2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 594-703 of human GYS2 (NP_068776.2).
Modifications Unmodified