Rabbit Polyclonal Anti-HIBADH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIBADH antibody: synthetic peptide directed towards the middle region of human HIBADH. Synthetic peptide located within the following region: AKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMG |
Rabbit Polyclonal Anti-HIBADH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIBADH antibody: synthetic peptide directed towards the middle region of human HIBADH. Synthetic peptide located within the following region: WSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPIL |
HIBADH Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 37-336 of human HIBADH (NP_689953.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China