Rabbit Polyclonal Anti-Jundm2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Jundm2 antibody: synthetic peptide directed towards the n terminal of mouse Jundm2. Synthetic peptide located within the following region: MMPGQIPDPSVTAGSLPGLGPLTGLPSSALTTEELKYADIRNIGAMIAPL |
Rabbit Polyclonal Anti-Jundm2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Jundm2 antibody: synthetic peptide directed towards the c terminal of mouse Jundm2. Synthetic peptide located within the following region: LKTQIEELKLERQQLILMLNRHRPTCIVRTDSVRTPESEGNPLLEQLDKK |
JDP2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
JDP2 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse JDP2 |
JDP2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-174 of human JDP2 (NP_001128521.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China