Antibodies

Jump to Filters
View as table Download
KCNQ3 Rabbit Polyclonal Antibody
TA371964

USD 380.00

4 Weeks

KCNQ3 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNQ3
KCNQ3 Rabbit Polyclonal Antibody
TA338539

USD 375.00

5 Days

Rabbit Polyclonal Anti-Kcnq3 Antibody

Applications WB
Reactivities Hamster, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Kcnq3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ