Antibodies

View as table Download

Rabbit polyclonal MMP10 (Cleaved-Phe99) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP10.

Rabbit anti-MMP10 Polyclonal Antibody

Applications WB
Reactivities Human Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human MMP10

Rabbit Polyclonal Anti-MMP10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP10 antibody: synthetic peptide directed towards the N terminal of human MMP10. Synthetic peptide located within the following region: MMHLAFLVLLCLPVCSAYPLSGAAKEEDSNKDLAQQYLEKYYNLEKDVKQ

Anti-MMP10 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 404-418 amino acids of Human matrix metallopeptidase 10 (stromelysin 2)

Anti-MMP10 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 404-418 amino acids of human matrix metallopeptidase 10 (stromelysin 2)