Antibodies

View as table Download

ONECUT1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ONECUT1

Rabbit Polyclonal Anti-ONECUT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ONECUT1 antibody: synthetic peptide directed towards the middle region of human ONECUT1. Synthetic peptide located within the following region: ITISQQLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA

Rabbit Polyclonal Anti-ONECUT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ONECUT1 antibody: synthetic peptide directed towards the N terminal of human ONECUT1. Synthetic peptide located within the following region: NAQLTMEAIGELHGVSHEPVPAPADLLGGSPHARSSVAHRGSHLPPAHPR

Carrier-free (BSA/glycerol-free) HNF6 mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Onecut1 Antibody - C-terminal region

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated

ONECUT1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ONECUT1

ONECUT1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 167-292 of human ONECUT1 (NP_004489.1).
Modifications Unmodified

ONECUT1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 167-292 of human ONECUT1 (NP_004489.1).
Modifications Unmodified

HNF6 mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HNF6 mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated