Antibodies

Jump to Filters
View as table Download
P2Y10 (P2RY10) Rabbit Polyclonal Antibody
TA331977

USD 375.00

5 Days

Rabbit Polyclonal Anti-P2RY10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-P2RY10 Antibody is: synthetic peptide directed towards the N-terminal region of Human P2RY10. Synthetic peptide located within the following region: NLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLAN
P2Y10 (P2RY10) Rabbit Polyclonal Antibody
TA379554

USD 220.00

3 Weeks

P2RY10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human P2RY10 (NP_001311147.1).
Modifications Unmodified