Antibodies

View as table Download

Rabbit Polyclonal Anti-PARS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PARS2 antibody is: synthetic peptide directed towards the C-terminal region of Human PARS2. Synthetic peptide located within the following region: AIEVLSTEDCVRWPSLLAPYQACLIPPKKGSKEQAASELIGQLYDHITEA

Rabbit Polyclonal Anti-PARS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PARS2 antibody is: synthetic peptide directed towards the N-terminal region of Human PARS2. Synthetic peptide located within the following region: GGQKVNMPSLSPAELWQATNRWDLMGKELLRLRDRHGKEYCLGPTHEEAI

PARS2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PARS2

PARS2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-220 of human PARS2 (NP_689481.2).
Modifications Unmodified

PARS2 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-220 of human PARS2 (NP_689481.2).
Modifications Unmodified