Antibodies

Jump to Filters
View as table Download
PMF1 Rabbit Polyclonal Antibody
TA343666

USD 475.00

5 Days

Rabbit Polyclonal Anti-PMF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PMF1 antibody: synthetic peptide directed towards the N terminal of human PMF1. Synthetic peptide located within the following region: MVDTFLQKLVAAGSYQRFTDCYKCFYQLQPAMTQRIYDKFIAQLQTSIRE
PMF1 Rabbit Polyclonal Antibody
TA380078

USD 220.00

3 Weeks

PMF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-205 of human PMF1 (NP_009152.2).