Phospho-RAC1-S71 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal Antibody against RAC1 (S71)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit Polyclonal Anti-RAC1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
Anti-RAC1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 198-211 amino acids of Human ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) |
RAC1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human RAC1 |
RAC1 Antibody - middle region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RAC1 |
Rac1/2/3 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-192 of human Rac1/2/3 (NP_008839.2). |
Modifications | Unmodified |
Phospho-Rac1/2/3-S71 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around S71 of human RAC1 (NP_008839.2). |
Modifications | Phospho S71 |