Antibodies

View as table Download

Rabbit Polyclonal Anti-RPIA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPIA Antibody: synthetic peptide directed towards the N terminal of human RPIA. Synthetic peptide located within the following region: MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG

Rpia Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

RPIA Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 82-311 of human RPIA (NP_653164.2).
Modifications Unmodified