Goat Polyclonal Antibody against SLC12A4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DPSHAPDNFRE, from the internal region of the protein sequence according to NP_005063.1. |
Goat Polyclonal Antibody against SLC12A4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DPSHAPDNFRE, from the internal region of the protein sequence according to NP_005063.1. |
Rabbit Polyclonal Anti-KCC1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)HAPDNFRELVHIK, corresponding to amino acid residues 998- 1010 of rat KCC1. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-SLC12A4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC12A4 Antibody: synthetic peptide directed towards the N terminal of human SLC12A4. Synthetic peptide located within the following region: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFL |