Antibodies

Jump to Filters
View as table Download
SLC12A4 Goat Polyclonal Antibody
TA303291

USD 375.00

5 Days

Goat Polyclonal Antibody against SLC12A4

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DPSHAPDNFRE, from the internal region of the protein sequence according to NP_005063.1.
Slc12a4 Rabbit Polyclonal Antibody
TA328867

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-KCC1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)HAPDNFRELVHIK, corresponding to amino acid residues 998- 1010 of rat KCC1. Intracellular, C-terminus.
SLC12A4 Rabbit Polyclonal Antibody
TA333951

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC12A4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC12A4 Antibody: synthetic peptide directed towards the N terminal of human SLC12A4. Synthetic peptide located within the following region: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFL