Antibodies

Jump to Filters
View as table Download
SLC5A9 Rabbit Polyclonal Antibody
TA351708

USD 345.00

In Stock

Rabbit Polyclonal Anti-SLC5A9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC5A9
SLC5A9 Rabbit Polyclonal Antibody
TA334145

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC5A9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC5A9 Antibody: synthetic peptide directed towards the N terminal of human SLC5A9. Synthetic peptide located within the following region: MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIA
SLC5A9 Rabbit Polyclonal Antibody
TA381686

USD 220.00

3 Weeks

SLC5A9 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 230-320 of human SLC5A9 (NP_001011547.2).
Modifications Unmodified