Rabbit Polyclonal THRAP3 Antibody
Applications | IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 930-955 of human Thyroid hormone receptor associated protein 3 was used as the immunogen |
Rabbit Polyclonal THRAP3 Antibody
Applications | IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 930-955 of human Thyroid hormone receptor associated protein 3 was used as the immunogen |
Rabbit Polyclonal Anti-Thrap3 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Thrap3 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Thrap3. Synthetic peptide located within the following region: MSKTNKSKSGSRSSRSRSASRSRSRSFSKSRSRSRSVSRSRKRRLSSRSR |
Rabbit Polyclonal Anti-THRAP3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-THRAP3 antibody: synthetic peptide directed towards the middle region of human THRAP3. Synthetic peptide located within the following region: GRGAFPRGRGRFMFRKSSTSPKWAHDKFSGEEGEIEDDESGTENREEKDN |
THRAP3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human THRAP3 |
Modifications | Unmodified |