Rabbit Polyclonal UBE2S Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody was made against a protein fragment from the C Terminus Region (NM_014501). |
Rabbit Polyclonal UBE2S Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody was made against a protein fragment from the C Terminus Region (NM_014501). |
Rabbit Polyclonal Antibody against UBE2S (C-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This E2EPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 192-222 amino acids from the C-terminal region of human E2EPF. |
Rabbit Polyclonal Antibody against UBE2S (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This E2EPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human E2EPF. |
Rabbit Polyclonal Anti-UBE2S Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBE2S antibody: synthetic peptide directed towards the N terminal of human UBE2S. Synthetic peptide located within the following region: NSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPE |
Carrier-free (BSA/glycerol-free) UBE2S mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2S mouse monoclonal antibody, clone OTI4B8 (formerly 4B8)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2S mouse monoclonal antibody, clone OTI4E4 (formerly 4E4)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2S mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2S mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-UBE2S Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UBE2S |
UBE2S Antibody - C-terminal region
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse UBE2S |
UBE2S Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 122-221 of human UBE2S (NP_055316.2). |
Modifications | Unmodified |
UBE2S mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
UBE2S mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
UBE2S mouse monoclonal antibody, clone OTI4B8 (formerly 4B8)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
UBE2S mouse monoclonal antibody, clone OTI4B8 (formerly 4B8)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
UBE2S mouse monoclonal antibody, clone OTI4E4 (formerly 4E4)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
UBE2S mouse monoclonal antibody, clone OTI4E4 (formerly 4E4)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
UBE2S mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
UBE2S mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
UBE2S mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
UBE2S mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |