WFDC1 Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 111-220 of human WFDC1 (NP_067020.2). |
WFDC1 Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 111-220 of human WFDC1 (NP_067020.2). |
WFDC1 Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 111-220 of human WFDC1 (NP_067020.2). |
Rabbit Polyclonal Anti-WFDC1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WFDC1 antibody: synthetic peptide directed towards the middle region of human WFDC1. Synthetic peptide located within the following region: VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF |
Rabbit Polyclonal Anti-WFDC1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WFDC1 antibody: synthetic peptide directed towards the N terminal of human WFDC1. Synthetic peptide located within the following region: WKRALPARLAEKSRAEEAGAPGGPRQPRADRCPPPPRTLPPGACQAARCQ |
Goat Polyclonal Antibody against Wfdc1 (mouse)
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RQRLHKEYPEGDSKN, from the internal region (near N Terminus) of the protein sequence according to NP_075884.1. |