Antibodies

Jump to Filters
View as table Download
WNT4 Goat Polyclonal Antibody
TA302700

USD 375.00

In Stock

Goat Polyclonal Antibody against WNT4

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SNWLYLAKLSSVGS, from the internal region of the protein sequence according to NP_110388.2.
WNT4 Rabbit Polyclonal Antibody
TA383336

USD 275.00

3 Weeks

WNT4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 122-351 of human WNT4 (NP_110388.2).
Modifications Unmodified
WNT4 Rabbit Polyclonal Antibody
TA383336S

USD 85.00

3 Weeks

WNT4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 122-351 of human WNT4 (NP_110388.2).
Modifications Unmodified
WNT4 Rabbit Polyclonal Antibody
TA329907

USD 375.00

5 Days

Rabbit Polyclonal Anti-WNT4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT4 antibody: synthetic peptide directed towards the middle region of human WNT4. Synthetic peptide located within the following region: HGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNE