Rabbit Polyclonal Anti-ZNF426 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF426 Antibody: synthetic peptide directed towards the N terminal of human ZNF426. Synthetic peptide located within the following region: VMLENYKNLATVGGQIIKPSLISWLEQEESRTVQGGVLQGWEMRLETQWS |
Rabbit Polyclonal Anti-ZNF426 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF426 Antibody: synthetic peptide directed towards the N terminal of human ZNF426. Synthetic peptide located within the following region: VMLENYKNLATVGGQIIKPSLISWLEQEESRTVQGGVLQGWEMRLETQWS |
ZNF426 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 150-270 of human ZNF426 (NP_077011.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China