Antibodies

View as table Download

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the middle region of human C2. Synthetic peptide located within the following region: INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS

Rabbit Polyclonal antibody to Complement C2 (complement component 2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 265 and 642 of Complement C2 (Uniprot ID#P06681)

C2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Hamster, Human
Immunogen KLH conjugated synthetic peptide between 147-176 amino acids from the N-terminal region of human C2

Carrier-free (BSA/glycerol-free) C2 mouse monoclonal antibody,clone OTI1A7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C2 mouse monoclonal antibody,clone OTI12G10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

C2 mouse monoclonal antibody,clone OTI1A7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

C2 mouse monoclonal antibody,clone OTI1A7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

C2 mouse monoclonal antibody,clone OTI12G10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

C2 mouse monoclonal antibody,clone OTI12G10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated