Antibodies

View as table Download

Rabbit Polyclonal Anti-EDF1 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDF1 antibody: synthetic peptide directed towards the middle region of human EDF1. Synthetic peptide located within the following region: INEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK

Goat Polyclonal Anti-EDF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen internal region of NP_003783.1; NP_694880.1 (NKQHSITKNTAKLDR)

Rabbit Polyclonal Anti-EDF1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDF1 antibody: synthetic peptide directed towards the N terminal of human EDF1. Synthetic peptide located within the following region: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK

Rabbit polyclonal Anti-EDF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDF1 antibody: synthetic peptide directed towards the N terminal of human EDF1. Synthetic peptide located within the following region: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK

Rabbit Polyclonal Anti-EDF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EDF1 antibody is: synthetic peptide directed towards the N-terminal region of Human EDF1. Synthetic peptide located within the following region: VTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNT

Carrier-free (BSA/glycerol-free) EDF1 mouse monoclonal antibody,clone OTI7B6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EDF1 mouse monoclonal antibody,clone OTI2G2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EDF1 mouse monoclonal antibody,clone OTI7D9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EDF1 mouse monoclonal antibody,clone OTI7B6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EDF1 mouse monoclonal antibody,clone OTI7B6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EDF1 mouse monoclonal antibody,clone OTI2G2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EDF1 mouse monoclonal antibody,clone OTI2G2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EDF1 mouse monoclonal antibody,clone OTI7D9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EDF1 mouse monoclonal antibody,clone OTI7D9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated