Antibodies

Jump to Filters
View as table Download
FNDC3B (N-term) Rabbit Polyclonal Antibody
AP18023PU-N

USD 450.00

2 Weeks

FNDC3B (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-term region of human FNDC3B
FNDC3B Rabbit Polyclonal Antibody
TA338617

USD 310.00

5 Days

Rabbit Polyclonal Anti-FNDC3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FNDC3B antibody: synthetic peptide directed towards the N terminal of human FNDC3B. Synthetic peptide located within the following region: RARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPP