Rabbit anti-KLK7 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human KLK7 |
Rabbit anti-KLK7 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human KLK7 |
Rabbit Polyclonal Anti-KLK7 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-KLK7 antibody is: synthetic peptide directed towards the middle region of Human KLK7. Synthetic peptide located within the following region: IKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGT |
Rabbit polyclonal antibody to KLK7 (kallikrein-related peptidase 7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 253 of KLK7 (Uniprot ID#P49862) |
Anti-KLK7 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 30-253 amino acids of human kallikrein-related peptidase 7kallikrein-related peptidase 7 |