Rabbit Monoclonal Antibody against RBL2 (Clone EP2141Y)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal Antibody against RBL2 (Clone EP2141Y)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rb2 p130 (RBL2) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 164-195 amino acids from the N-terminal region of Human RBL2. |
Rabbit polyclonal pRb2 p130 antibody
Applications | WB |
Reactivities | Chimpanzee, Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared by repeated immunizations with a synthetic peptide corresponding to the Spa310 sequence of pRb2/p130 protein. A residue of cysteine was added to facilitate coupling. |
Rabbit Polyclonal anti-RBL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RBL2 antibody is: synthetic peptide directed towards the C-terminal region of Human RBL2. Synthetic peptide located within the following region: NETMLSPREKIFYYFSNSPSKRLREINSMIRTGETPTKKRGILLEDGSES |
Rabbit Polyclonal Anti-RBL2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RBL2 antibody is: synthetic peptide directed towards the C-terminal region of Human RBL2. Synthetic peptide located within the following region: SKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQD |