Antibodies

View as table Download

Rb2 p130 (RBL2) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 164-195 amino acids from the N-terminal region of Human RBL2.

Rabbit polyclonal pRb2 p130 antibody

Applications WB
Reactivities Chimpanzee, Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared by repeated immunizations with a synthetic peptide corresponding to the Spa310 sequence of pRb2/p130 protein. A residue of cysteine was added to facilitate coupling.

Rabbit Polyclonal anti-RBL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RBL2 antibody is: synthetic peptide directed towards the C-terminal region of Human RBL2. Synthetic peptide located within the following region: NETMLSPREKIFYYFSNSPSKRLREINSMIRTGETPTKKRGILLEDGSES

Rabbit Polyclonal Anti-RBL2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-RBL2 antibody is: synthetic peptide directed towards the C-terminal region of Human RBL2. Synthetic peptide located within the following region: SKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQD