RPLP2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 20~49 amino acids from the N-terminal region of Human RPLP2. |
RPLP2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 20~49 amino acids from the N-terminal region of Human RPLP2. |
Rabbit Polyclonal Anti-RPLP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RPLP2 antibody is: synthetic peptide directed towards the N-terminal region of Human RPLP2. Synthetic peptide located within the following region: MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKN |
Rabbit Polyclonal Anti-RPLP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RPLP2 |