Rabbit Polyclonal Anti-P2Y14 Receptor (extracellular)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide CIELKSELGRKWHKASN, corresponding to amino acid residues 172-188 of human P2Y14. 2nd extracellular loop. |
Rabbit Polyclonal Anti-P2Y14 Receptor (extracellular)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide CIELKSELGRKWHKASN, corresponding to amino acid residues 172-188 of human P2Y14. 2nd extracellular loop. |
Rabbit Polyclonal Anti-P2RY14 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-P2RY14 antibody is: synthetic peptide directed towards the C-terminal region of Human P2RY14. Synthetic peptide located within the following region: YTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREI |
P2RY14 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |