Germany
Japan
United Kingdom
China
USD 370.00
2 Weeks
Glutamate receptor ionotropic, NMDA 2D (GRIN2D) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Antibodies
View as table Download
Rabbit Polyclonal NMDAR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR1 |
NMDAR1 (GRIN1) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human NMDAR1 |
Rabbit Anti-NMDA NR2C Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the N-terminal region of the NR2C subunit |
Rabbit Polyclonal Anti-Phospho-NMDAR1(Ser897) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-NMDAR1(Ser897) Antibody: A synthesized peptide derived from human NMDAR1 around the phosphorylation site of Sersine 897 |
| Modifications | Phospho-specific |
Rabbit Polyclonal NMDAR1 (Ser890) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR1 around the phosphorylation site of Serine 890 |
| Modifications | Phospho-specific |
Rabbit Polyclonal NMDAR1 (Ser897) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR1 around the phosphorylation site of Serine 897 |
| Modifications | Phospho-specific |
Anti-GRIN1 (Phospho-Ser896) Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 896 (R-R-S(p)-S-K) derived from Human NMDAR1. |
| Modifications | Phospho-specific |
Rabbit Polyclonal NMDAR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR1 |
Rabbit Polyclonal Anti-GRIN2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST |
Rabbit Anti-NMDA NR2A Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2A subunit |
Rabbit Anti-NMDA NR2A Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2A subunit |
Phospho-GRIN1-S896 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S896 of human GRIN1 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GRIN2C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRIN2C antibody: synthetic peptide directed towards the N terminal of human GRIN2C. Synthetic peptide located within the following region: VNTTNPSSLLTQICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVP |
Active filters
Applications
- WB
Families
- Ion Channels: Glutamate Receptors
Pathways
- Calcium signaling pathway