Antibodies

View as table Download

GRIA3 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIA3

Rabbit Polyclonal Anti-Gria3 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Gria3 antibody is: synthetic peptide directed towards the middle region of Rat Gria3. Synthetic peptide located within the following region: TVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYM

Rabbit Polyclonal Anti-Gria3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Gria3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EEMDRRQEKRYLIDCEVERINTILEQVVILGKHSRGYHYMLANLGFTDIV