Antibodies

Jump to Filters
View as table Download
TTYH1 Rabbit Polyclonal Antibody
TA319973

USD 430.00

5 Days

Rabbit Polyclonal TTYH1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TTYH1 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human TTYH1.
TTYH1 Rabbit Polyclonal Antibody
TA335497

USD 375.00

5 Days

Rabbit Polyclonal Anti-TTYH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TTYH1 Antibody: synthetic peptide directed towards the N terminal of human TTYH1. Synthetic peptide located within the following region: GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA