Antibodies

Jump to Filters
View as table Download
Carboxypeptidase H (CPE) Rabbit Polyclonal Antibody
TA344338

USD 475.00

5 Days

Rabbit Polyclonal Anti-CPE Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPE antibody: synthetic peptide directed towards the N terminal of human CPE. Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG
Granzyme B (GZMB) Rabbit Polyclonal Antibody
TA332552

USD 275.00

3 Weeks

Rabbit anti-GZMB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GZMB
Granzyme B (GZMB) Rabbit Polyclonal Antibody
TA312131

USD 345.00

4 Weeks

Rabbit polyclonal Granzyme B antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Granzyme B.
Carboxypeptidase H (CPE) Rabbit Polyclonal Antibody
TA332699

USD 275.00

3 Weeks

Rabbit anti-CPE Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CPE
Granzyme B (GZMB) Rabbit Polyclonal Antibody
TA347396

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Granzyme B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Granzyme B Antibody: A synthesized peptide derived from human Granzyme B
Carboxypeptidase H (CPE) Rabbit Polyclonal Antibody
TA313672

USD 345.00

In Stock

Rabbit polyclonal anti-CPE antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CPE.Purification: The antibody was affinity-purified from
Granzyme B (GZMB) Mouse Monoclonal Antibody [Clone ID: OTI4E6]
CF505930

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GZMB mouse monoclonal antibody,clone OTI4E6

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Granzyme B (GZMB) Mouse Monoclonal Antibody [Clone ID: OTI4E4]
CF505931

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GZMB mouse monoclonal antibody, clone OTI4E4 (formerly 4E4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Granzyme B (GZMB) Mouse Monoclonal Antibody [Clone ID: OTI4E4]
TA505931

USD 379.00

In Stock

GZMB (Granzyme B) mouse monoclonal antibody, clone OTI4E4 (formerly 4E4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Granzyme B (GZMB) Mouse Monoclonal Antibody [Clone ID: OTI4E4]
TA505931S

USD 159.00

In Stock

GZMB (Granzyme B) mouse monoclonal antibody, clone OTI4E4 (formerly 4E4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated