Antibodies

Jump to Filters
View as table Download
CDC2L6 (CDK19) Rabbit Polyclonal Antibody
TA334062

USD 375.00

5 Days

Rabbit Polyclonal Anti-CDK19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CDK19 Antibody is: synthetic peptide directed towards the C-terminal region of Human CDK19. Synthetic peptide located within the following region: LLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDDP
CDC2L6 (CDK19) Rabbit Polyclonal Antibody
TA351063

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-CDK19 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CDK19