Antibodies

View as table Download

Goat Polyclonal Antibody against FSTL1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TAEKTKRVSTKEI, from the C Terminus of the protein sequence according to NP_009016.1.

Rabbit Polyclonal FSTL1 Antibody

Applications ELISA, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

FSTL1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 285~318 amino acids from the C-terminal region of Human Follistatin-related protein 1

Rabbit Polyclonal Anti-FSTL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FSTL1 antibody: synthetic peptide directed towards the C terminal of human FSTL1. Synthetic peptide located within the following region: LNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKN