Anti-Human RELMβ Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human RELMβ |
Anti-Human RELMβ Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human RELMβ |
Rabbit polyclonal anti-RELM-beta antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E. coli expressed recombinant human RELM-β |
Rabbit Polyclonal Anti-RETNLB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RETNLB antibody: synthetic peptide directed towards the N terminal of human RETNLB. Synthetic peptide located within the following region: CSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVT |