Rabbit Polyclonal SCUBE3 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | SCUBE3 antibody was raised against a 15 amino acid synthetic peptide near the center of human SCUBE3. |
Rabbit Polyclonal SCUBE3 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | SCUBE3 antibody was raised against a 15 amino acid synthetic peptide near the center of human SCUBE3. |
Rabbit Polyclonal Anti-SCUBE3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SCUBE3 antibody is: synthetic peptide directed towards the N-terminal region of Human SCUBE3. Synthetic peptide located within the following region: MNCMNKNHGCAHICRETPKGGIACECRPGFELTKNQRDCKLTCNYGNGGC |