Rabbit Polyclonal Anti-ADNP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADNP antibody: synthetic peptide directed towards the N terminal of human ADNP. Synthetic peptide located within the following region: EDFKQFEPNDFYLKNTTWEDVGLWDPSLTKNQDYRTKPFCCSACPFSSKF |
Rabbit Polyclonal Anti-ADNP Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADNP Antibody: A synthesized peptide derived from human ADNP |
Rabbit polyclonal anti-ADNP antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADNP. |
Germany
Japan
United Kingdom
China