Antibodies

Jump to Filters
View as table Download
HEY2 Rabbit Polyclonal Antibody
TA315251

USD 345.00

4 Weeks

Rabbit polyclonal anti-HEY2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HEY2.
HEY2 Rabbit Polyclonal Antibody
TA343694

USD 475.00

5 Days

Rabbit Polyclonal Anti-HEY2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HEY2 antibody: synthetic peptide directed towards the middle region of human HEY2. Synthetic peptide located within the following region: PMLPPNAAAAVAAATAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGA