Antibodies

Jump to Filters
View as table Download
LZTR1 Rabbit Polyclonal Antibody
TA343637

USD 410.00

5 Days

Rabbit Polyclonal Anti-LZTR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LZTR1 antibody: synthetic peptide directed towards the C terminal of human LZTR1. Synthetic peptide located within the following region: GFYNNRLQAYCKQNLEMNVTVQNVLQILEAADKTQALDMKRHCLHIIVHQ
LZTR1 Rabbit Polyclonal Antibody
TA343636

USD 475.00

5 Days

Rabbit Polyclonal Anti-LZTR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LZTR1 antibody: synthetic peptide directed towards the N terminal of human LZTR1. Synthetic peptide located within the following region: AGPGSTGGQIGAAALAGGARSKVAPSVDFDHSCSDSVEYLTLNFGPFETV
LZTR1 Rabbit Polyclonal Antibody
TA306929

USD 430.00

5 Days

Rabbit Polyclonal LZTR1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LZTR1 antibody was raised against a 14 amino acid peptide near the amino terminus of human LZTR1.