Antibodies

Jump to Filters
View as table Download
NPAS4 Goat Polyclonal Antibody
TA311604

USD 375.00

5 Days

Goat Anti-NPAS4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CRFNTSKSLRRQS, from the internal region of the protein sequence according to NP_849195.2.
NPAS4 Rabbit Polyclonal Antibody
TA330603

USD 375.00

5 Days

Rabbit Polyclonal Anti-NPAS4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NPAS4 antibody: synthetic peptide directed towards the middle region of human NPAS4. Synthetic peptide located within the following region: QAHLDSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTL