Rabbit Polyclonal Anti-PHF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF1 antibody: synthetic peptide directed towards the N terminal of human PHF1. Synthetic peptide located within the following region: MAQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGT |
Rabbit Polyclonal Anti-PHF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF1 antibody: synthetic peptide directed towards the C terminal of human PHF1. Synthetic peptide located within the following region: SAPPSPLCRSLSPGTGGGVRGGVGYLSRGDPVRVLARRVRPDGSVQYLVE |
Rabbit Polyclonal Anti-PHF1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF1 Antibody: A synthesized peptide derived from human PHF1 |
Rabbit polyclonal anti-PHF1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PHF1. |
Rabbit Polyclonal Anti-PHF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PHF1 Antibody: synthetic peptide directed towards the C terminal of human PHF1. Synthetic peptide located within the following region: PSPNQSYQGSSGYNFRPTDARCLPSSPIRMFASFHPSASTAGTSGDSGPP |
Germany
Japan
United Kingdom
China
