Antibodies

View as table Download

Rabbit Polyclonal Anti-ADA2L Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ADA2L Antibody: A synthesized peptide derived from human ADA2L

Rabbit polyclonal anti-ADA2L antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADA2L.

ADA2a (TADA2A) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 201-230 amino acids from the Central region of human TADA2L

Rabbit Polyclonal Anti-TADA2L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TADA2L Antibody: synthetic peptide directed towards the C terminal of human TADA2L. Synthetic peptide located within the following region: RRQADIDSGLSPSIPMASNSGRRSAPPLNLTGLPGTEKLNEKEKELCQMV

Rabbit Polyclonal Anti-TADA2L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TADA2L antibody: synthetic peptide directed towards the N terminal of human TADA2L. Synthetic peptide located within the following region: MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGF

Rabbit Polyclonal Anti-TADA2L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TADA2L antibody: synthetic peptide directed towards the middle region of human TADA2L. Synthetic peptide located within the following region: LEYKSALLNECNKQGGLRLAQARALIKIDVNKTRKIYDFLIREGYITKG